SCOPe 2.08: Domain d2h28a1: 2h28 A:16-122

Lineage for d2h28a1 (2h28 A:16-122)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.8: YeeU-like [143737] (1 family)
   beta(2)-alpha-beta(3); 2 layers, a/b; there is an oligomerization interface instead of the 'missing' helical layer
   automatically mapped to Pfam PF06154

5. Family d.110.8.1: YagB/YeeU/YfjZ-like [143738] (2 proteins)
   Pfam PF06154

6. Protein Hypothetical protein YeeU [143741] (2 species)

7. Species Escherichia coli [TaxId:562] [143742] (1 PDB entry)
   Uniprot P76364 16-122

8. Domain d2h28a1: 2h28 A:16-122 [135995]
   Other proteins in same PDB: d2h28a2
   complexed with cl, gol, mg

Details for d2h28a1

PDB Entry: 2h28, 2.1 Å

PDB Description: crystal structure of yeeu from e. coli. northeast structural genomics target er304

PDB Compounds: (A:) Hypothetical protein yeeU

SCOPe Domain Sequences for d2h28a1:

Sequence; same for both SEQRES and ATOM records:

>d2h28a1 d.110.8.1 (A:16-122) Hypothetical protein YeeU {Escherichia coli [TaxId: 562]}
drpwwglpctvtpcfgarlvqegnrlhyladragirglfsdadayhldqafpllmkqlel
mltsgelnprhqhtvtlyakgltckadtlsscdyvylavyptpemkn

Timeline for d2h28a1:

• d2h28a1 first appeared in SCOP 1.73
  
• d2h28a1 appears in SCOPe 2.07