SCOPe 2.05: Domain d2h26a2: 2h26 A:4-183

Lineage for d2h26a2 (2h26 A:4-183)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Human (Homo sapiens), CD1b [TaxId:9606] [75378] (10 PDB entries)

8. Domain d2h26a2: 2h26 A:4-183 [135991]
   Other proteins in same PDB: d2h26a1, d2h26b_
   automated match to d3t8xc1
   complexed with 6pl, 6ul, gol, so4

Details for d2h26a2

PDB Entry: 2h26, 1.8 Å

PDB Description: human cd1b in complex with endogenous phosphatidylcholine and spacer

PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d2h26a2:

Sequence; same for both SEQRES and ATOM records:

>d2h26a2 d.19.1.1 (A:4-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1b [TaxId: 9606]}
fqgptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdkev
aeleeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggldf
lsvknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlqr

Timeline for d2h26a2:

• d2h26a2 first appeared in SCOP 1.73
  
• d2h26a2 appears in SCOPe 2.04
  
• d2h26a2 appears in SCOPe 2.06
  
• d2h26a2 appears in the current release, SCOPe 2.08