Lineage for d2h26a2 (2h26 A:7-183)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719354Protein CD1, alpha-1 and alpha-2 domains [54456] (3 species)
    Class I MHC-related
  7. 719355Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (3 PDB entries)
  8. 719356Domain d2h26a2: 2h26 A:7-183 [135991]
    Other proteins in same PDB: d2h26a1, d2h26b1
    automatically matched to d1onqa2
    complexed with 6pl, 6ul, fuc, gol, nag, so4; mutant

Details for d2h26a2

PDB Entry: 2h26 (more details), 1.8 Å

PDB Description: human cd1b in complex with endogenous phosphatidylcholine and spacer
PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOP Domain Sequences for d2h26a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h26a2 d.19.1.1 (A:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
ptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdkevael
eeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggldflsv
knascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlqr

SCOP Domain Coordinates for d2h26a2:

Click to download the PDB-style file with coordinates for d2h26a2.
(The format of our PDB-style files is described here.)

Timeline for d2h26a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h26a1
View in 3D
Domains from other chains:
(mouse over for more information)
d2h26b1