SCOP 1.73: Domain d2h24a1: 2h24 A:18-159

Lineage for d2h24a1 (2h24 A:18-159)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species)
   intertwined dimer, similar to interferon-gamma

7. Species Human (Homo sapiens) [TaxId:9606] [47307] (7 PDB entries)

8. Domain d2h24a1: 2h24 A:18-159 [135988]
   automatically matched to d2ilk__

Details for d2h24a1

PDB Entry: 2h24, 2 Å

PDB Description: Crystal structure of human IL-10

PDB Compounds: (A:) interleukin-10

SCOP Domain Sequences for d2h24a1:

Sequence, based on SEQRES records:

>d2h24a1 a.26.1.3 (A:18-159) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Human (Homo sapiens) [TaxId: 9606]}
nlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgylgcqalsemiqfyleevm
pqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkskaveqvknafnklqekgiy
kamsefdifinyieaymtmkir

Sequence, based on observed residues (ATOM records):

>d2h24a1 a.26.1.3 (A:18-159) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Human (Homo sapiens) [TaxId: 9606]}
nlpnmlrdlrdafsrvktffdqldnlllkeslledfkgylgcqalsemiqfyleevmpqa
enqdpdikahvnslgenlktlrlrlrrchrflpcenkskaveqvknafnklqekgiykam
sefdifinyieaymtmkir

Timeline for d2h24a1:

• d2h24a1 is new in SCOP 1.73
  
• d2h24a1 appears in SCOP 1.75
  
• d2h24a1 appears in the current release, SCOPe 2.08, called d2h24a_