SCOPe 2.08: Domain d2h24a_: 2h24 A:

Lineage for d2h24a_ (2h24 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein automated matches [190141] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187124] (4 PDB entries)

8. Domain d2h24a_: 2h24 A: [135988]
   automated match to d2ilk__

Details for d2h24a_

PDB Entry: 2h24, 2 Å

PDB Description: Crystal structure of human IL-10

PDB Compounds: (A:) interleukin-10

SCOPe Domain Sequences for d2h24a_:

Sequence, based on SEQRES records:

>d2h24a_ a.26.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgylgcqalsemiqfyleevm
pqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkskaveqvknafnklqekgiy
kamsefdifinyieaymtmkir

Sequence, based on observed residues (ATOM records):

>d2h24a_ a.26.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlpnmlrdlrdafsrvktffdqldnlllkeslledfkgylgcqalsemiqfyleevmpqa
enqdpdikahvnslgenlktlrlrlrrchrflpcenkskaveqvknafnklqekgiykam
sefdifinyieaymtmkir

Timeline for d2h24a_:

• d2h24a_ first appeared in SCOP 1.73, called d2h24a1
  
• d2h24a_ appears in SCOPe 2.07