| Class b: All beta proteins [48724] (165 folds) |
| Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.7: SET domain [82199] (3 families) ![]() duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII also contains a substrate-binding alpha+beta subdomain inserted in the core |
| Family b.85.7.3: RuBisCo LSMT catalytic domain [82210] (1 protein) |
| Protein RuBisCo LSMT catalytic domain [82211] (1 species) |
| Species Garden pea (Pisum sativum) [TaxId:3888] [82212] (7 PDB entries) |
| Domain d2h23c2: 2h23 C:50-310 [135987] Other proteins in same PDB: d2h23a1, d2h23b1, d2h23c1 automatically matched to d1ozvb2 complexed with m3l, sah |
PDB Entry: 2h23 (more details), 2.45 Å
SCOP Domain Sequences for d2h23c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h23c2 b.85.7.3 (C:50-310) RuBisCo LSMT catalytic domain {Garden pea (Pisum sativum) [TaxId: 3888]}
lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda
vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq
gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlrn
enlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqydl
nksnaelaldygfiepnenrh
Timeline for d2h23c2:
View in 3DDomains from other chains: (mouse over for more information) d2h23a1, d2h23a2, d2h23b1, d2h23b2 |