Lineage for d2h23c2 (2h23 C:50-310)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818606Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
    Pfam PF00856
  5. 2818661Family b.85.7.3: RuBisCo LSMT catalytic domain [82210] (1 protein)
  6. 2818662Protein RuBisCo LSMT catalytic domain [82211] (1 species)
  7. 2818663Species Pea (Pisum sativum) [TaxId:3888] [82212] (7 PDB entries)
  8. 2818675Domain d2h23c2: 2h23 C:50-310 [135987]
    Other proteins in same PDB: d2h23a1, d2h23a3, d2h23b1, d2h23b3, d2h23c1, d2h23c3
    automated match to d1p0ya2
    complexed with m3l, sah

Details for d2h23c2

PDB Entry: 2h23 (more details), 2.45 Å

PDB Description: structure of rubisco lsmt bound to trimethyllysine and adohcy
PDB Compounds: (C:) Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase

SCOPe Domain Sequences for d2h23c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h23c2 b.85.7.3 (C:50-310) RuBisCo LSMT catalytic domain {Pea (Pisum sativum) [TaxId: 3888]}
lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda
vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq
gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlrn
enlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqydl
nksnaelaldygfiepnenrh

SCOPe Domain Coordinates for d2h23c2:

Click to download the PDB-style file with coordinates for d2h23c2.
(The format of our PDB-style files is described here.)

Timeline for d2h23c2: