![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.166: RuBisCo LSMT C-terminal, substrate-binding domain [81821] (1 superfamily) multihelical; irregular array of long and short helices |
![]() | Superfamily a.166.1: RuBisCo LSMT C-terminal, substrate-binding domain [81822] (1 family) ![]() |
![]() | Family a.166.1.1: RuBisCo LSMT C-terminal, substrate-binding domain [81823] (1 protein) |
![]() | Protein RuBisCo LSMT C-terminal, substrate-binding domain [81824] (1 species) |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [81825] (7 PDB entries) |
![]() | Domain d2h23b1: 2h23 B:311-482 [135984] Other proteins in same PDB: d2h23a2, d2h23a3, d2h23b2, d2h23b3, d2h23c2, d2h23c3 automated match to d1p0yb1 complexed with m3l, sah |
PDB Entry: 2h23 (more details), 2.45 Å
SCOPe Domain Sequences for d2h23b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h23b1 a.166.1.1 (B:311-482) RuBisCo LSMT C-terminal, substrate-binding domain {Pea (Pisum sativum) [TaxId: 3888]} aytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlvalggtdaf lleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelkegnldsrl aiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdil
Timeline for d2h23b1: