SCOP 1.73: Domain d2h23b1: 2h23 B:311-486

Lineage for d2h23b1 (2h23 B:311-486)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.166: RuBisCo LSMT C-terminal, substrate-binding domain [81821] (1 superfamily)
   multihelical; irregular array of long and short helices

4. Superfamily a.166.1: RuBisCo LSMT C-terminal, substrate-binding domain [81822] (1 family)

5. Family a.166.1.1: RuBisCo LSMT C-terminal, substrate-binding domain [81823] (1 protein)

6. Protein RuBisCo LSMT C-terminal, substrate-binding domain [81824] (1 species)

7. Species Garden pea (Pisum sativum) [TaxId:3888] [81825] (7 PDB entries)

8. Domain d2h23b1: 2h23 B:311-486 [135984]
   Other proteins in same PDB: d2h23a2, d2h23b2, d2h23c2
   automatically matched to d1mlvb1
   complexed with m3l, sah

Details for d2h23b1

PDB Entry: 2h23, 2.45 Å

PDB Description: structure of rubisco lsmt bound to trimethyllysine and adohcy

PDB Compounds: (B:) Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase

SCOP Domain Sequences for d2h23b1:

Sequence; same for both SEQRES and ATOM records:

>d2h23b1 a.166.1.1 (B:311-486) RuBisCo LSMT C-terminal, substrate-binding domain {Garden pea (Pisum sativum) [TaxId: 3888]}
aytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlvalggtdaf
lleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelkegnldsrl
aiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdilenly

Timeline for d2h23b1:

• d2h23b1 is new in SCOP 1.73
  
• d2h23b1 appears in SCOP 1.75
  
• d2h23b1 appears in the current release, SCOPe 2.08