Lineage for d2h21c1 (2h21 C:311-482)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735757Fold a.166: RuBisCo LSMT C-terminal, substrate-binding domain [81821] (1 superfamily)
    multihelical; irregular array of long and short helices
  4. 2735758Superfamily a.166.1: RuBisCo LSMT C-terminal, substrate-binding domain [81822] (1 family) (S)
  5. 2735759Family a.166.1.1: RuBisCo LSMT C-terminal, substrate-binding domain [81823] (1 protein)
  6. 2735760Protein RuBisCo LSMT C-terminal, substrate-binding domain [81824] (1 species)
  7. 2735761Species Pea (Pisum sativum) [TaxId:3888] [81825] (7 PDB entries)
  8. 2735776Domain d2h21c1: 2h21 C:311-482 [135980]
    Other proteins in same PDB: d2h21a2, d2h21a3, d2h21b2, d2h21b3, d2h21c2, d2h21c3
    automated match to d1p0yb1
    complexed with sam

Details for d2h21c1

PDB Entry: 2h21 (more details), 2.45 Å

PDB Description: structure of rubisco lsmt bound to adomet
PDB Compounds: (C:) Ribulose-1,5 bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d2h21c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h21c1 a.166.1.1 (C:311-482) RuBisCo LSMT C-terminal, substrate-binding domain {Pea (Pisum sativum) [TaxId: 3888]}
aytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlvalggtdaf
lleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelkegnldsrl
aiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdil

SCOPe Domain Coordinates for d2h21c1:

Click to download the PDB-style file with coordinates for d2h21c1.
(The format of our PDB-style files is described here.)

Timeline for d2h21c1: