Lineage for d2h21b2 (2h21 B:50-310)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678386Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 678656Superfamily b.85.7: SET domain [82199] (3 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
  5. 678687Family b.85.7.3: RuBisCo LSMT catalytic domain [82210] (1 protein)
  6. 678688Protein RuBisCo LSMT catalytic domain [82211] (1 species)
  7. 678689Species Garden pea (Pisum sativum) [TaxId:3888] [82212] (7 PDB entries)
  8. 678700Domain d2h21b2: 2h21 B:50-310 [135979]
    Other proteins in same PDB: d2h21a1, d2h21b1, d2h21c1
    automatically matched to d1ozvb2
    complexed with sam

Details for d2h21b2

PDB Entry: 2h21 (more details), 2.45 Å

PDB Description: structure of rubisco lsmt bound to adomet
PDB Compounds: (B:) Ribulose-1,5 bisphosphate carboxylase/oxygenase

SCOP Domain Sequences for d2h21b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h21b2 b.85.7.3 (B:50-310) RuBisCo LSMT catalytic domain {Garden pea (Pisum sativum) [TaxId: 3888]}
lspavqtfwkwlqeegvitaktpvkasvvteglglvalkdisrndvilqvpkrlwinpda
vaaseigrvcselkpwlsvilflirersredsvwkhyfgilpqetdstiywseeelqelq
gsqllkttvsvkeyvkneclkleqeiilpnkrlfpdpvtlddffwafgilrsrafsrlrn
enlvvvpmadlinhsagvttedhayevkgaaglfswdylfslksplsvkageqvyiqydl
nksnaelaldygfiepnenrh

SCOP Domain Coordinates for d2h21b2:

Click to download the PDB-style file with coordinates for d2h21b2.
(The format of our PDB-style files is described here.)

Timeline for d2h21b2: