| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.166: RuBisCo LSMT C-terminal, substrate-binding domain [81821] (1 superfamily) multihelical; irregular array of long and short helices |
Superfamily a.166.1: RuBisCo LSMT C-terminal, substrate-binding domain [81822] (1 family) ![]() |
| Family a.166.1.1: RuBisCo LSMT C-terminal, substrate-binding domain [81823] (1 protein) |
| Protein RuBisCo LSMT C-terminal, substrate-binding domain [81824] (1 species) |
| Species Pea (Pisum sativum) [TaxId:3888] [81825] (7 PDB entries) |
| Domain d2h21b1: 2h21 B:311-482 [135978] Other proteins in same PDB: d2h21a2, d2h21a3, d2h21b2, d2h21b3, d2h21c2, d2h21c3 automated match to d1p0yb1 complexed with sam |
PDB Entry: 2h21 (more details), 2.45 Å
SCOPe Domain Sequences for d2h21b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h21b1 a.166.1.1 (B:311-482) RuBisCo LSMT C-terminal, substrate-binding domain {Pea (Pisum sativum) [TaxId: 3888]}
aytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlvalggtdaf
lleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelkegnldsrl
aiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdil
Timeline for d2h21b1: