| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.120.1: PIN domain-like [88723] (2 families) ![]() |
| Family c.120.1.1: PIN domain [89619] (7 proteins) Pfam PF01850 |
| Protein Trafficking protein B [142110] (1 species) |
| Species Neisseria gonorrhoeae [TaxId:485] [142111] (3 PDB entries) |
| Domain d2h1od1: 2h1o D:1-138 [135974] automatically matched to 2BSQ A:1-138 complexed with 5iu; mutant |
PDB Entry: 2h1o (more details), 3 Å
SCOP Domain Sequences for d2h1od1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h1od1 c.120.1.1 (D:1-138) Trafficking protein B {Neisseria gonorrhoeae [TaxId: 485]}
milldtnviseplrpqpnervvawldsliledvylsaitvaemrlgvalllngkkknvlh
ermeqsilplfagrilpfdepvaaiyaqirsyakthgkeiaaadgyiaatakqhsmtvat
rdtgsffaadvavfnpwh
Timeline for d2h1od1: