Lineage for d2h1od1 (2h1o D:1-138)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712940Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 712941Superfamily c.120.1: PIN domain-like [88723] (2 families) (S)
  5. 712942Family c.120.1.1: PIN domain [89619] (7 proteins)
    Pfam PF01850
  6. 712986Protein Trafficking protein B [142110] (1 species)
  7. 712987Species Neisseria gonorrhoeae [TaxId:485] [142111] (3 PDB entries)
  8. 712996Domain d2h1od1: 2h1o D:1-138 [135974]
    automatically matched to 2BSQ A:1-138
    complexed with 5iu; mutant

Details for d2h1od1

PDB Entry: 2h1o (more details), 3 Å

PDB Description: structure of fitab bound to ir36 dna fragment
PDB Compounds: (D:) trafficking protein b

SCOP Domain Sequences for d2h1od1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h1od1 c.120.1.1 (D:1-138) Trafficking protein B {Neisseria gonorrhoeae [TaxId: 485]}
milldtnviseplrpqpnervvawldsliledvylsaitvaemrlgvalllngkkknvlh
ermeqsilplfagrilpfdepvaaiyaqirsyakthgkeiaaadgyiaatakqhsmtvat
rdtgsffaadvavfnpwh

SCOP Domain Coordinates for d2h1od1:

Click to download the PDB-style file with coordinates for d2h1od1.
(The format of our PDB-style files is described here.)

Timeline for d2h1od1: