Lineage for d2h1oc1 (2h1o C:1-138)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529111Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2529112Superfamily c.120.1: PIN domain-like [88723] (3 families) (S)
  5. 2529113Family c.120.1.1: PIN domain [89619] (7 proteins)
    Pfam PF01850
  6. 2529162Protein Trafficking protein B [142110] (1 species)
  7. 2529163Species Neisseria gonorrhoeae [TaxId:485] [142111] (3 PDB entries)
    Uniprot Q5F882 1-138! Uniprot Q9RF91 1-138
  8. 2529167Domain d2h1oc1: 2h1o C:1-138 [135973]
    Other proteins in same PDB: d2h1oa2, d2h1ob2, d2h1oc2, d2h1od2, d2h1oe1, d2h1of1, d2h1og1, d2h1oh1
    automatically matched to 2BSQ A:1-138
    protein/DNA complex

Details for d2h1oc1

PDB Entry: 2h1o (more details), 3 Å

PDB Description: structure of fitab bound to ir36 dna fragment
PDB Compounds: (C:) trafficking protein b

SCOPe Domain Sequences for d2h1oc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h1oc1 c.120.1.1 (C:1-138) Trafficking protein B {Neisseria gonorrhoeae [TaxId: 485]}
milldtnviseplrpqpnervvawldsliledvylsaitvaemrlgvalllngkkknvlh
ermeqsilplfagrilpfdepvaaiyaqirsyakthgkeiaaadgyiaatakqhsmtvat
rdtgsffaadvavfnpwh

SCOPe Domain Coordinates for d2h1oc1:

Click to download the PDB-style file with coordinates for d2h1oc1.
(The format of our PDB-style files is described here.)

Timeline for d2h1oc1: