SCOPe 2.07: Domain d2h1lt2: 2h1l T:92-289

Lineage for d2h1lt2 (2h1l T:92-289)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49420] (65 PDB entries)

8. Domain d2h1lt2: 2h1l T:92-289 [135966]
   Other proteins in same PDB: d2h1la_, d2h1lb_, d2h1lc_, d2h1ld_, d2h1le_, d2h1lf_, d2h1lg_, d2h1lh_, d2h1li_, d2h1lj_, d2h1lk_, d2h1ll_, d2h1lm3, d2h1ln3, d2h1lo3, d2h1lp3, d2h1lq3, d2h1lr3, d2h1ls3, d2h1lt3, d2h1lu3, d2h1lv3, d2h1lw3, d2h1lx3
   automated match to d3kmda_
   complexed with zn

Details for d2h1lt2

PDB Entry: 2h1l, 3.16 Å

PDB Description: the structure of the oncoprotein sv40 large t antigen and p53 tumor suppressor complex

PDB Compounds: (T:) Cellular tumor antigen p53

SCOPe Domain Sequences for d2h1lt2:

Sequence; same for both SEQRES and ATOM records:

>d2h1lt2 b.2.5.2 (T:92-289) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
plsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstp
ppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrnt
frhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfe
vrvcacpgrdrrteeenl

Timeline for d2h1lt2:

• d2h1lt2 first appeared in SCOP 1.73, called d2h1lt1
  
• d2h1lt2 appears in SCOPe 2.06
  
• d2h1lt2 appears in the current release, SCOPe 2.08