Lineage for d2h1lm2 (2h1l M:92-289)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377721Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2377722Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2377723Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 2377724Species Human (Homo sapiens) [TaxId:9606] [49420] (65 PDB entries)
  8. 2377863Domain d2h1lm2: 2h1l M:92-289 [135959]
    Other proteins in same PDB: d2h1la_, d2h1lb_, d2h1lc_, d2h1ld_, d2h1le_, d2h1lf_, d2h1lg_, d2h1lh_, d2h1li_, d2h1lj_, d2h1lk_, d2h1ll_, d2h1lm3, d2h1ln3, d2h1lo3, d2h1lp3, d2h1lq3, d2h1lr3, d2h1ls3, d2h1lt3, d2h1lu3, d2h1lv3, d2h1lw3, d2h1lx3
    automated match to d3kmda_
    complexed with zn

Details for d2h1lm2

PDB Entry: 2h1l (more details), 3.16 Å

PDB Description: the structure of the oncoprotein sv40 large t antigen and p53 tumor suppressor complex
PDB Compounds: (M:) Cellular tumor antigen p53

SCOPe Domain Sequences for d2h1lm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h1lm2 b.2.5.2 (M:92-289) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
plsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstp
ppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrnt
frhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfe
vrvcacpgrdrrteeenl

SCOPe Domain Coordinates for d2h1lm2:

Click to download the PDB-style file with coordinates for d2h1lm2.
(The format of our PDB-style files is described here.)

Timeline for d2h1lm2: