Lineage for d2h1lf1 (2h1l F:266-627)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 990157Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 990371Protein Papillomavirus large T antigen helicase domain [89688] (1 species)
  7. 990372Species Simian virus 40 [TaxId:10633] [89689] (5 PDB entries)
    Uniprot P03070 265-627
  8. 990391Domain d2h1lf1: 2h1l F:266-627 [135952]
    Other proteins in same PDB: d2h1lm1, d2h1ln1, d2h1lo1, d2h1lp1, d2h1lq1, d2h1lr1, d2h1ls1, d2h1lt1, d2h1lu1, d2h1lv1, d2h1lw1, d2h1lx1
    automatically matched to d1svla_
    complexed with zn

Details for d2h1lf1

PDB Entry: 2h1l (more details), 3.16 Å

PDB Description: the structure of the oncoprotein sv40 large t antigen and p53 tumor suppressor complex
PDB Compounds: (F:) large t antigen

SCOPe Domain Sequences for d2h1lf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h1lf1 c.37.1.20 (F:266-627) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}
kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa
ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie
ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg
kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv
kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle
kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv
ld

SCOPe Domain Coordinates for d2h1lf1:

Click to download the PDB-style file with coordinates for d2h1lf1.
(The format of our PDB-style files is described here.)

Timeline for d2h1lf1: