Lineage for d2h1le1 (2h1l E:266-627)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 697666Family c.37.1.20: Extended AAA-ATPase domain [81269] (27 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 697877Protein Papillomavirus large T antigen helicase domain [89688] (1 species)
  7. 697878Species Simian virus 40 [TaxId:10633] [89689] (5 PDB entries)
  8. 697896Domain d2h1le1: 2h1l E:266-627 [135951]
    Other proteins in same PDB: d2h1lm1, d2h1ln1, d2h1lo1, d2h1lp1, d2h1lq1, d2h1lr1, d2h1ls1, d2h1lt1, d2h1lu1, d2h1lv1, d2h1lw1, d2h1lx1
    automatically matched to d1svla_
    complexed with zn

Details for d2h1le1

PDB Entry: 2h1l (more details), 3.16 Å

PDB Description: the structure of the oncoprotein sv40 large t antigen and p53 tumor suppressor complex
PDB Compounds: (E:) large t antigen

SCOP Domain Sequences for d2h1le1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h1le1 c.37.1.20 (E:266-627) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}
kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa
ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie
ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg
kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv
kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle
kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv
ld

SCOP Domain Coordinates for d2h1le1:

Click to download the PDB-style file with coordinates for d2h1le1.
(The format of our PDB-style files is described here.)

Timeline for d2h1le1: