Lineage for d2h1la_ (2h1l A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849193Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 1849414Protein Papillomavirus large T antigen helicase domain [89688] (1 species)
  7. 1849415Species Simian virus 40 [TaxId:10633] [89689] (5 PDB entries)
    Uniprot P03070 265-627
  8. 1849429Domain d2h1la_: 2h1l A: [135947]
    Other proteins in same PDB: d2h1lm_, d2h1ln_, d2h1lo_, d2h1lp_, d2h1lq_, d2h1lr_, d2h1ls_, d2h1lt_, d2h1lu_, d2h1lv_, d2h1lw_, d2h1lx_
    automated match to d1svmc_
    complexed with zn

Details for d2h1la_

PDB Entry: 2h1l (more details), 3.16 Å

PDB Description: the structure of the oncoprotein sv40 large t antigen and p53 tumor suppressor complex
PDB Compounds: (A:) large t antigen

SCOPe Domain Sequences for d2h1la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h1la_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}
kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa
ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie
ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg
kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv
kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle
kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv
ld

SCOPe Domain Coordinates for d2h1la_:

Click to download the PDB-style file with coordinates for d2h1la_.
(The format of our PDB-style files is described here.)

Timeline for d2h1la_: