SCOPe 2.08: Domain d2h1ca1: 2h1c A:1-138

Lineage for d2h1ca1 (2h1c A:1-138)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (4 families)

5. Family c.120.1.1: PIN domain [89619] (7 proteins)
   Pfam PF01850

6. Protein Trafficking protein B [142110] (1 species)

7. Species Neisseria gonorrhoeae [TaxId:485] [142111] (3 PDB entries)
   Uniprot Q5F882 1-138! Uniprot Q9RF91 1-138

8. Domain d2h1ca1: 2h1c A:1-138 [135944]
   Other proteins in same PDB: d2h1ca2
   complexed with the C-terminal segment of Trafficking protein A (chain B)
   complexed with act, mg, so4

Details for d2h1ca1

PDB Entry: 2h1c, 1.8 Å

PDB Description: Crystal Structure of FitAcB from Neisseria gonorrhoeae

PDB Compounds: (A:) trafficking protein b

SCOPe Domain Sequences for d2h1ca1:

Sequence; same for both SEQRES and ATOM records:

>d2h1ca1 c.120.1.1 (A:1-138) Trafficking protein B {Neisseria gonorrhoeae [TaxId: 485]}
milldtnviseplrpqpnervvawldsliledvylsaitvaelrlgvalllngkkknvlh
erleqsilplfagrilpfdepvaaiyaqirsyakthgkeiaaadgyiaatakqhsltvat
rdtgsffaadvavfnpwh

Timeline for d2h1ca1:

• d2h1ca1 first appeared in SCOP 1.73
  
• d2h1ca1 appears in SCOPe 2.07