Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.36: Thiopurine S-methyltransferase [102566] (1 protein) automatically mapped to Pfam PF05724 |
Protein Thiopurine S-methyltransferase [102567] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [142579] (2 PDB entries) Uniprot P51580 17-245 |
Domain d2h11b_: 2h11 B: [135942] automated match to d2bzga1 complexed with b3p, sah, scn |
PDB Entry: 2h11 (more details), 1.89 Å
SCOPe Domain Sequences for d2h11b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h11b_ c.66.1.36 (B:) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} evqknqvltleewqdkwvngktafhqeqghqllkkhldtflkgksglrvffplcgkavem kwfadrghsvvgveiselgiqeffteqnlsyseepiteipgtkvfksssgnislyccsif dlprtnigkfdmiwdrgalvainpgdrkcyadtmfsllgkkfqyllcvlsydptkhpgpp fyvphaeierlfgkicnirclekvdafeerhkswgidclfeklylltek
Timeline for d2h11b_: