SCOPe 2.08: Domain d2h11a_: 2h11 A:

Lineage for d2h11a_ (2h11 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.36: Thiopurine S-methyltransferase [102566] (1 protein)
   automatically mapped to Pfam PF05724

6. Protein Thiopurine S-methyltransferase [102567] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142579] (2 PDB entries)
   Uniprot P51580 17-245

8. Domain d2h11a_: 2h11 A: [135941]
   automated match to d2bzga1
   complexed with b3p, sah, scn

Details for d2h11a_

PDB Entry: 2h11, 1.89 Å

PDB Description: amino-terminal truncated thiopurine s-methyltransferase complexed with s-adenosyl-l-homocysteine

PDB Compounds: (A:) thiopurine s-methyltransferase

SCOPe Domain Sequences for d2h11a_:

Sequence; same for both SEQRES and ATOM records:

>d2h11a_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}
evqknqvltleewqdkwvngktafhqeqghqllkkhldtflkgksglrvffplcgkavem
kwfadrghsvvgveiselgiqeffteqnlsyseepiteipgtkvfksssgnislyccsif
dlprtnigkfdmiwdrgalvainpgdrkcyadtmfsllgkkfqyllcvlsydptkhpgpp
fyvphaeierlfgkicnirclekvdafeerhkswgidclfeklylltek

Timeline for d2h11a_:

• d2h11a_ first appeared in SCOP 1.73, called d2h11a1
  
• d2h11a_ appears in SCOPe 2.07