Lineage for d2h01a1 (2h01 A:2-171)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877753Protein Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) [52906] (3 species)
  7. 2877804Species Plasmodium yoelii [TaxId:5861] [142366] (1 PDB entry)
    Uniprot Q86SB2 8-177
  8. 2877805Domain d2h01a1: 2h01 A:2-171 [135928]
    Other proteins in same PDB: d2h01a2

Details for d2h01a1

PDB Entry: 2h01 (more details), 2.3 Å

PDB Description: py00414- plasmodium yoelii thioredoxin peroxidase i
PDB Compounds: (A:) 2-cys peroxiredoxin

SCOPe Domain Sequences for d2h01a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]}
qapsfkaeavfgdntfgevslsdfigkkyvllyfypldftfvcpseiialdkaldsfker
nvellgcsvdskfthlawkktplsqggignikhtlisdisksiarsydvlfnesvalraf
vlidkqgvvqhllvnnlalgrsvdeilrlidalqhhekygdvcpanwqkg

SCOPe Domain Coordinates for d2h01a1:

Click to download the PDB-style file with coordinates for d2h01a1.
(The format of our PDB-style files is described here.)

Timeline for d2h01a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h01a2