SCOPe 2.08: Domain d2h01a1: 2h01 A:2-171

Lineage for d2h01a1 (2h01 A:2-171)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) [52906] (3 species)

7. Species Plasmodium yoelii [TaxId:5861] [142366] (1 PDB entry)
   Uniprot Q86SB2 8-177

8. Domain d2h01a1: 2h01 A:2-171 [135928]
   Other proteins in same PDB: d2h01a2

Details for d2h01a1

PDB Entry: 2h01, 2.3 Å

PDB Description: py00414- plasmodium yoelii thioredoxin peroxidase i

PDB Compounds: (A:) 2-cys peroxiredoxin

SCOPe Domain Sequences for d2h01a1:

Sequence; same for both SEQRES and ATOM records:

>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]}
qapsfkaeavfgdntfgevslsdfigkkyvllyfypldftfvcpseiialdkaldsfker
nvellgcsvdskfthlawkktplsqggignikhtlisdisksiarsydvlfnesvalraf
vlidkqgvvqhllvnnlalgrsvdeilrlidalqhhekygdvcpanwqkg

Timeline for d2h01a1:

• d2h01a1 first appeared in SCOP 1.73
  
• d2h01a1 appears in SCOPe 2.07