![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
![]() | Protein Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) [52906] (3 species) |
![]() | Species Plasmodium yoelii [TaxId:5861] [142366] (1 PDB entry) Uniprot Q86SB2 8-177 |
![]() | Domain d2h01a1: 2h01 A:2-171 [135928] Other proteins in same PDB: d2h01a2 |
PDB Entry: 2h01 (more details), 2.3 Å
SCOPe Domain Sequences for d2h01a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} qapsfkaeavfgdntfgevslsdfigkkyvllyfypldftfvcpseiialdkaldsfker nvellgcsvdskfthlawkktplsqggignikhtlisdisksiarsydvlfnesvalraf vlidkqgvvqhllvnnlalgrsvdeilrlidalqhhekygdvcpanwqkg
Timeline for d2h01a1: