![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.54: Methyltransferase 10 domain [142651] (2 proteins) Pfam PF05971; DUF890 |
![]() | Protein automated matches [190671] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187777] (2 PDB entries) |
![]() | Domain d2h00b_: 2h00 B: [135926] Other proteins in same PDB: d2h00a1 automated match to d2h00a1 complexed with cl, dtu, sah |
PDB Entry: 2h00 (more details), 2 Å
SCOPe Domain Sequences for d2h00b_:
Sequence, based on SEQRES records: (download)
>d2h00b_ c.66.1.54 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nfkdpeavraltctllredfglsidiplerliptvplrlnyihwvedlighqdsdkstlr rgidigtgasciypllgatlngwyflatevddmcfnyakknveqnnlsdlikvvkvpqkt llmdalkeeseiiydfcmcnppffanqleakgvnsrnprrpppssvntggiteimaegge lefvkriihdslqlkkrlrwyscmlgkkcslaplkeelriqgvpkvtytefcqgrtmrwa lawsfy
>d2h00b_ c.66.1.54 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} nfkdpeavraltctllredfglsidiplerliptvplrlnyihwvedlighqdsdkstlr rgidigtgasciypllgatlngwyflatevddmcfnyakknveqnnlsdlikvvkvpqkt llmdiiydfcmcnppffanqlggelefvkriihdslqlkkrlrwyscmlgkkcslaplke elriqgvpkvtytefcqgrtmrwalawsfy
Timeline for d2h00b_: