![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
![]() | Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
![]() | Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [51212] (32 PDB entries) |
![]() | Domain d2gzwd2: 2gzw D:7-137 [135924] Other proteins in same PDB: d2gzwa1, d2gzwb1, d2gzwc1, d2gzwd1 automated match to d1i5zb2 complexed with cmp |
PDB Entry: 2gzw (more details), 2.21 Å
SCOPe Domain Sequences for d2gzwd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gzwd2 b.82.3.2 (D:7-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} tdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnq gdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqv tsekvgnlafl
Timeline for d2gzwd2: