SCOPe 2.08: Domain d2gzwc2: 2gzw C:7-137

Lineage for d2gzwc2 (2gzw C:7-137)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)

7. Species Escherichia coli [TaxId:562] [51212] (32 PDB entries)

8. Domain d2gzwc2: 2gzw C:7-137 [135922]
   Other proteins in same PDB: d2gzwa1, d2gzwb1, d2gzwc1, d2gzwd1
   automated match to d1i5za2
   complexed with cmp

Details for d2gzwc2

PDB Entry: 2gzw, 2.21 Å

PDB Description: crystal structure of the e.coli crp-camp complex

PDB Compounds: (C:) Catabolite gene activator

SCOPe Domain Sequences for d2gzwc2:

Sequence; same for both SEQRES and ATOM records:

>d2gzwc2 b.82.3.2 (C:7-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}
tdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnq
gdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqv
tsekvgnlafl

Timeline for d2gzwc2:

• d2gzwc2 first appeared in SCOP 1.73
  
• d2gzwc2 appears in SCOPe 2.07