Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins) |
Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species) N-terminal domain has double beta-helix fold |
Species Escherichia coli [TaxId:562] [46798] (28 PDB entries) |
Domain d2gzwc1: 2gzw C:138-206 [135921] Other proteins in same PDB: d2gzwa2, d2gzwb2, d2gzwc2, d2gzwd2 automated match to d1i5za1 complexed with cmp |
PDB Entry: 2gzw (more details), 2.21 Å
SCOPe Domain Sequences for d2gzwc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gzwc1 a.4.5.4 (C:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis ahgktivvy
Timeline for d2gzwc1: