Lineage for d2gzwc1 (2gzw C:138-206)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693005Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)
  6. 2693006Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
    N-terminal domain has double beta-helix fold
  7. 2693007Species Escherichia coli [TaxId:562] [46798] (28 PDB entries)
  8. 2693035Domain d2gzwc1: 2gzw C:138-206 [135921]
    Other proteins in same PDB: d2gzwa2, d2gzwb2, d2gzwc2, d2gzwd2
    automated match to d1i5za1
    complexed with cmp

Details for d2gzwc1

PDB Entry: 2gzw (more details), 2.21 Å

PDB Description: crystal structure of the e.coli crp-camp complex
PDB Compounds: (C:) Catabolite gene activator

SCOPe Domain Sequences for d2gzwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gzwc1 a.4.5.4 (C:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvy

SCOPe Domain Coordinates for d2gzwc1:

Click to download the PDB-style file with coordinates for d2gzwc1.
(The format of our PDB-style files is described here.)

Timeline for d2gzwc1: