SCOPe 2.06: Domain d2gzwb1: 2gzw B:138-203

Lineage for d2gzwb1 (2gzw B:138-203)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)

6. Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
   N-terminal domain has double beta-helix fold

7. Species Escherichia coli [TaxId:562] [46798] (27 PDB entries)

8. Domain d2gzwb1: 2gzw B:138-203 [135919]
   Other proteins in same PDB: d2gzwa2, d2gzwb2, d2gzwc2, d2gzwd2
   automated match to d1i5za1
   complexed with cmp

Details for d2gzwb1

PDB Entry: 2gzw, 2.21 Å

PDB Description: crystal structure of the e.coli crp-camp complex

PDB Compounds: (B:) Catabolite gene activator

SCOPe Domain Sequences for d2gzwb1:

Sequence; same for both SEQRES and ATOM records:

>d2gzwb1 a.4.5.4 (B:138-203) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgkti

Timeline for d2gzwb1:

• d2gzwb1 first appeared in SCOP 1.73
  
• d2gzwb1 appears in SCOPe 2.05
  
• d2gzwb1 appears in SCOPe 2.07
  
• d2gzwb1 appears in the current release, SCOPe 2.08