SCOPe 2.08: Domain d2gzwa1: 2gzw A:138-206

Lineage for d2gzwa1 (2gzw A:138-206)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)

6. Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
   N-terminal domain has double beta-helix fold

7. Species Escherichia coli [TaxId:562] [46798] (28 PDB entries)

8. Domain d2gzwa1: 2gzw A:138-206 [135917]
   Other proteins in same PDB: d2gzwa2, d2gzwb2, d2gzwc2, d2gzwd2
   automated match to d1i5za1
   complexed with cmp

Details for d2gzwa1

PDB Entry: 2gzw, 2.21 Å

PDB Description: crystal structure of the e.coli crp-camp complex

PDB Compounds: (A:) Catabolite gene activator

SCOPe Domain Sequences for d2gzwa1:

Sequence; same for both SEQRES and ATOM records:

>d2gzwa1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvy

Timeline for d2gzwa1:

• d2gzwa1 first appeared in SCOP 1.73
  
• d2gzwa1 appears in SCOPe 2.07