SCOPe 2.07: Domain d2gzua_: 2gzu A:

Lineage for d2gzua_ (2gzu A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.3: SinR domain-like [47432] (9 proteins)

6. Protein Putative transcription regulator CylR2 [109811] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [109812] (10 PDB entries)
   Uniprot Q8VL32

8. Domain d2gzua_: 2gzu A: [135915]
   automated match to d2xi8a_

Details for d2gzua_

PDB Entry: 2gzu

PDB Description: high-resolution structure determination of the cylr2 homodimer using intermonomer distances from paramagnetic relaxation enhancement and nmr dipolar couplings

PDB Compounds: (A:) cytolysin regulator 2

SCOPe Domain Sequences for d2gzua_:

Sequence; same for both SEQRES and ATOM records:

>d2gzua_ a.35.1.3 (A:) Putative transcription regulator CylR2 {Enterococcus faecalis [TaxId: 1351]}
miinnlklirekkkisqselaallevsrqtingieknkynpslqlalkiayylntpledi
fqwqpe

Timeline for d2gzua_:

• d2gzua_ first appeared in SCOP 1.73, called d2gzua1
  
• d2gzua_ appears in SCOPe 2.06
  
• d2gzua_ appears in the current release, SCOPe 2.08