Lineage for d2gztb1 (2gzt B:5-148)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741266Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
    alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234
  4. 741267Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family) (S)
  5. 741268Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (1 protein)
  6. 741269Protein Hut operon positive regulatory protein HutP [111066] (1 species)
    an RNA-binding antitermination protein
  7. 741270Species Bacillus subtilis [TaxId:1423] [111067] (10 PDB entries)
  8. 741276Domain d2gztb1: 2gzt B:5-148 [135913]
    automatically matched to d1veab_
    complexed with his, mg; mutant

Details for d2gztb1

PDB Entry: 2gzt (more details), 1.7 Å

PDB Description: Crystal structure of the HutP antitermination complex bound to the HUT mRNA
PDB Compounds: (B:) Hut operon positive regulatory protein

SCOP Domain Sequences for d2gztb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gztb1 d.275.1.1 (B:5-148) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]}
kerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskksgvi
qsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavs
lygtigapikglehetfgvginhi

SCOP Domain Coordinates for d2gztb1:

Click to download the PDB-style file with coordinates for d2gztb1.
(The format of our PDB-style files is described here.)

Timeline for d2gztb1:

  • d2gztb1 is new in SCOP 1.73
  • d2gztb1 does not appear in SCOP 1.75