SCOPe 2.04: Domain d2gzpa_: 2gzp A:

Lineage for d2gzpa_ (2gzp A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.20: HyaE-like [142401] (2 proteins)
   Pfam PF07449; have evolved a different function; contains no conserved cysteine residues

6. Protein Hydrogenase-1 operon protein HyaE [142402] (3 species)

7. Species Salmonella typhimurium [TaxId:99287] [255196] (1 PDB entry)

8. Domain d2gzpa_: 2gzp A: [135911]
   automated match to d2hfda1

Details for d2gzpa_

PDB Entry: 2gzp

PDB Description: Solution NMR structure of Q8ZP25 from Salmonella typhimurium LT2; Northeast Structural Genomics Consortium Target STR70

PDB Compounds: (A:) putative chaperone

SCOPe Domain Sequences for d2gzpa_:

Sequence; same for both SEQRES and ATOM records:

>d2gzpa_ c.47.1.20 (A:) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 99287]}
mandtpfsalwqrlltrgwqpveastvddwikrvgdgvillssdprrtpevsdnpvmiae
llrefpqfdwqvavadleqseaigdrfnvrrfpatlvftdgklrgalsgihpwaelltlm
rsivdtpaaqetvq

Timeline for d2gzpa_:

• d2gzpa_ first appeared in SCOP 1.73, called d2gzpa1
  
• d2gzpa_ was called d2gzpa1 in SCOPe 2.03
  
• d2gzpa_ appears in SCOPe 2.05
  
• d2gzpa_ appears in the current release, SCOPe 2.08