Lineage for d2gzpa1 (2gzp A:7-125)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1169652Family c.47.1.20: HyaE-like [142401] (2 proteins)
    Pfam PF07449; have evolved a different function; contains no conserved cysteine residues
  6. 1169653Protein Hydrogenase-1 operon protein HyaE [142402] (2 species)
  7. 1169656Species Salmonella typhimurium [TaxId:90371] [142404] (2 PDB entries)
    Uniprot Q8ZP25 7-125
  8. 1169661Domain d2gzpa1: 2gzp A:7-125 [135911]
    automatically matched to 2ES7 A:7-125

Details for d2gzpa1

PDB Entry: 2gzp (more details)

PDB Description: Solution NMR structure of Q8ZP25 from Salmonella typhimurium LT2; Northeast Structural Genomics Consortium Target STR70
PDB Compounds: (A:) putative chaperone

SCOPe Domain Sequences for d2gzpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gzpa1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]}
fsalwqrlltrgwqpveastvddwikrvgdgvillssdprrtpevsdnpvmiaellrefp
qfdwqvavadleqseaigdrfnvrrfpatlvftdgklrgalsgihpwaelltlmrsivd

SCOPe Domain Coordinates for d2gzpa1:

Click to download the PDB-style file with coordinates for d2gzpa1.
(The format of our PDB-style files is described here.)

Timeline for d2gzpa1: