SCOP 1.73: Domain d2gzpa1: 2gzp A:7-125

Lineage for d2gzpa1 (2gzp A:7-125)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.20: HyaE-like [142401] (1 protein)
   Pfam PF07449; have evolved a different function; contains no conserved cysteine residues

6. Protein Hydrogenase-1 operon protein HyaE [142402] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [142404] (2 PDB entries)

8. Domain d2gzpa1: 2gzp A:7-125 [135911]
   automatically matched to 2ES7 A:7-125

Details for d2gzpa1

PDB Entry: 2gzp

PDB Description: Solution NMR structure of Q8ZP25 from Salmonella typhimurium LT2; Northeast Structural Genomics Consortium Target STR70

PDB Compounds: (A:) putative chaperone

SCOP Domain Sequences for d2gzpa1:

Sequence; same for both SEQRES and ATOM records:

>d2gzpa1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 602]}
fsalwqrlltrgwqpveastvddwikrvgdgvillssdprrtpevsdnpvmiaellrefp
qfdwqvavadleqseaigdrfnvrrfpatlvftdgklrgalsgihpwaelltlmrsivd

Timeline for d2gzpa1:

• d2gzpa1 is new in SCOP 1.73
  
• d2gzpa1 appears in SCOP 1.75
  
• d2gzpa1 appears in the current release, SCOPe 2.08, called d2gzpa_