Lineage for d2gzpa_ (2gzp A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878879Family c.47.1.20: HyaE-like [142401] (2 proteins)
    Pfam PF07449; have evolved a different function; contains no conserved cysteine residues
  6. 2878880Protein Hydrogenase-1 operon protein HyaE [142402] (3 species)
  7. 2878889Species Salmonella typhimurium [TaxId:99287] [255196] (1 PDB entry)
  8. 2878890Domain d2gzpa_: 2gzp A: [135911]
    automated match to d2hfda1

Details for d2gzpa_

PDB Entry: 2gzp (more details)

PDB Description: Solution NMR structure of Q8ZP25 from Salmonella typhimurium LT2; Northeast Structural Genomics Consortium Target STR70
PDB Compounds: (A:) putative chaperone

SCOPe Domain Sequences for d2gzpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gzpa_ c.47.1.20 (A:) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 99287]}
mandtpfsalwqrlltrgwqpveastvddwikrvgdgvillssdprrtpevsdnpvmiae
llrefpqfdwqvavadleqseaigdrfnvrrfpatlvftdgklrgalsgihpwaelltlm
rsivdtpaaqetvq

SCOPe Domain Coordinates for d2gzpa_:

Click to download the PDB-style file with coordinates for d2gzpa_.
(The format of our PDB-style files is described here.)

Timeline for d2gzpa_: