Lineage for d2gzoa1 (2gzo A:1-187)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2242514Fold d.310: VC0467-like [143455] (1 superfamily)
    complex fold; contains bifurcated beta-sheet structure folded into pseudo barrel
  4. 2242515Superfamily d.310.1: VC0467-like [143456] (2 families) (S)
    automatically mapped to Pfam PF02622
  5. 2242516Family d.310.1.1: VC0467-like [143457] (5 proteins)
    Pfam PF02622; DUF179
  6. 2242517Protein Hypotheical protein SO3346 [143466] (1 species)
  7. 2242518Species Shewanella oneidensis [TaxId:70863] [143467] (1 PDB entry)
    Uniprot Q8EBZ9 1-187
  8. 2242519Domain d2gzoa1: 2gzo A:1-187 [135910]

Details for d2gzoa1

PDB Entry: 2gzo (more details)

PDB Description: nmr structure of upf0301 protein so3346 from shewanella oneidensis: northeast structural genomics consortium target sor39
PDB Compounds: (A:) UPF0301 protein SO3346

SCOPe Domain Sequences for d2gzoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gzoa1 d.310.1.1 (A:1-187) Hypotheical protein SO3346 {Shewanella oneidensis [TaxId: 70863]}
meslqnhfliampslddtffertviylcehdekgamglvinkplgievnslleqmdlpte
qvsadlamgsqvlmggpvsqdrgfvlhtsqpywanstelgsglmlttsrdvltaigskrs
pdkflvalgyagwsknqleqeladnswltipadhallfdinhedrwqqasrslgfeawql
stqagha

SCOPe Domain Coordinates for d2gzoa1:

Click to download the PDB-style file with coordinates for d2gzoa1.
(The format of our PDB-style files is described here.)

Timeline for d2gzoa1: