SCOP 1.73: Domain d2gzla1: 2gzl A:-1-157

Lineage for d2gzla1 (2gzl A:-1-157)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (1 family)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: IpsF-like [69766] (2 proteins)

6. Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (4 species)

7. Species Escherichia coli [TaxId:562] [69768] (11 PDB entries)

8. Domain d2gzla1: 2gzl A:-1-157 [135909]
   automatically matched to d1h48c_
   complexed with 2aa, gpp, zn

Details for d2gzla1

PDB Entry: 2gzl, 2.5 Å

PDB Description: Structure of 2C-methyl-D-erythritol 2,4-clycodiphosphate synthase complexed with a CDP derived fluorescent inhibitor

PDB Compounds: (A:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOP Domain Sequences for d2gzla1:

Sequence; same for both SEQRES and ATOM records:

>d2gzla1 d.79.5.1 (A:-1-157) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli [TaxId: 562]}
lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
dlgchmddvnvkattteklgftgrgegiaceavallika

Timeline for d2gzla1:

• d2gzla1 is new in SCOP 1.73
  
• d2gzla1 appears in SCOP 1.75
  
• d2gzla1 appears in the current release, SCOPe 2.08, called d2gzla2