Lineage for d2gzka2 (2gzk A:3-75)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697956Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 2697957Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 2697958Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 2698010Protein SRY [47104] (1 species)
  7. 2698011Species Human (Homo sapiens) [TaxId:9606] [47105] (5 PDB entries)
  8. 2698014Domain d2gzka2: 2gzk A:3-75 [135908]
    Other proteins in same PDB: d2gzka1
    automatically matched to d1hrya_
    protein/DNA complex

Details for d2gzka2

PDB Entry: 2gzk (more details)

PDB Description: structure of a complex of tandem hmg boxes and dna
PDB Compounds: (A:) Sex-determining region on Y / HMGB1

SCOPe Domain Sequences for d2gzka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gzka2 a.21.1.1 (A:3-75) SRY {Human (Homo sapiens) [TaxId: 9606]}
drvkrpmnafivwsrdqrrkmalenprmrnseiskqlgyqwkmlteaekwpffqeaqklq
amhrekypnykyr

SCOPe Domain Coordinates for d2gzka2:

Click to download the PDB-style file with coordinates for d2gzka2.
(The format of our PDB-style files is described here.)

Timeline for d2gzka2: