Lineage for d2gzka1 (2gzk A:87-159)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637383Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 637384Superfamily a.21.1: HMG-box [47095] (1 family) (S)
  5. 637385Family a.21.1.1: HMG-box [47096] (9 proteins)
  6. 637386Protein High mobility group protein 1, HMG1 [47097] (2 species)
    duplication: contains HMG-box domains
  7. 637387Species Hamster (Cricetulus griseus) [TaxId:10029] [47099] (5 PDB entries)
  8. 637388Domain d2gzka1: 2gzk A:87-159 [135907]
    Other proteins in same PDB: d2gzka2
    automatically matched to d1hsm__

Details for d2gzka1

PDB Entry: 2gzk (more details)

PDB Description: structure of a complex of tandem hmg boxes and dna
PDB Compounds: (A:) Sex-determining region on Y / HMGB1

SCOP Domain Sequences for d2gzka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gzka1 a.21.1.1 (A:87-159) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]}
napkrppsafflfcseyrpkikgehpglsigdvakklgemwnntaaddkqpyekkaaklk
ekyekdiaayrak

SCOP Domain Coordinates for d2gzka1:

Click to download the PDB-style file with coordinates for d2gzka1.
(The format of our PDB-style files is described here.)

Timeline for d2gzka1: