SCOPe 2.08: Domain d2gzka1: 2gzk A:87-159

Lineage for d2gzka1 (2gzk A:87-159)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.1: HMG-box [47096] (10 proteins)

6. Protein High mobility group protein 1, HMG1 [47097] (2 species)
   duplication: contains HMG-box domains

7. Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [47099] (5 PDB entries)

8. Domain d2gzka1: 2gzk A:87-159 [135907]
   Other proteins in same PDB: d2gzka2
   automatically matched to d1hsm__
   protein/DNA complex

Details for d2gzka1

PDB Entry: 2gzk

PDB Description: structure of a complex of tandem hmg boxes and dna

PDB Compounds: (A:) Sex-determining region on Y / HMGB1

SCOPe Domain Sequences for d2gzka1:

Sequence; same for both SEQRES and ATOM records:

>d2gzka1 a.21.1.1 (A:87-159) High mobility group protein 1, HMG1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
napkrppsafflfcseyrpkikgehpglsigdvakklgemwnntaaddkqpyekkaaklk
ekyekdiaayrak

Timeline for d2gzka1:

• d2gzka1 first appeared in SCOP 1.73
  
• d2gzka1 appears in SCOPe 2.07