SCOPe 2.03: Domain d2gzdd_: 2gzd D:

Lineage for d2gzdd_ (2gzd D:)

1. Root: SCOPe 2.03

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.31: Eferin C-derminal domain-like [144270] (1 family)

5. Family h.1.31.1: Eferin C-derminal domain-like [144271] (2 proteins)
   contains PfamB PB042332, PfamB PB026102

6. Protein Rab11 family-interacting protein 2 [144272] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144273] (2 PDB entries)
   Uniprot Q7L804 468-502

8. Domain d2gzdd_: 2gzd D: [135904]
   Other proteins in same PDB: d2gzda_, d2gzdb_
   automated match to d2gzdc1
   complexed with gtp, mg

Details for d2gzdd_

PDB Entry: 2gzd, 2.44 Å

PDB Description: crystal structure of rab11 in complex with rab11-fip2

PDB Compounds: (D:) Rab11 family-interacting protein 2

SCOPe Domain Sequences for d2gzdd_:

Sequence; same for both SEQRES and ATOM records:

>d2gzdd_ h.1.31.1 (D:) Rab11 family-interacting protein 2 {Human (Homo sapiens) [TaxId: 9606]}
rrkdthireledyidnllvrvmeetpsilrvpyep

Timeline for d2gzdd_:

• d2gzdd_ first appeared in SCOP 1.73, called d2gzdd1
  
• d2gzdd_ was called d2gzdd1 in SCOPe 2.02
  
• d2gzdd_ appears in SCOPe 2.04
  
• d2gzdd_ appears in the current release, SCOPe 2.08