Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (33 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.31: Eferin C-derminal domain-like [144270] (1 family) |
Family h.1.31.1: Eferin C-derminal domain-like [144271] (2 proteins) contains PfamB 042332, PfamB 026102 |
Protein Rab11 family-interacting protein 2 [144272] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [144273] (2 PDB entries) |
Domain d2gzdd1: 2gzd D:468-502 [135904] Other proteins in same PDB: d2gzda1, d2gzdb1 automatically matched to 2GZD C:468-502 complexed with gtp, mg; mutant |
PDB Entry: 2gzd (more details), 2.44 Å
SCOP Domain Sequences for d2gzdd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gzdd1 h.1.31.1 (D:468-502) Rab11 family-interacting protein 2 {Human (Homo sapiens) [TaxId: 9606]} rrkdthireledyidnllvrvmeetpsilrvpyep
Timeline for d2gzdd1: