![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.31: Eferin C-derminal domain-like [144270] (1 family) ![]() |
![]() | Family h.1.31.1: Eferin C-derminal domain-like [144271] (3 proteins) contains PfamB PB042332, PfamB PB026102 |
![]() | Protein Rab11 family-interacting protein 2 [144272] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [144273] (2 PDB entries) Uniprot Q7L804 468-502 |
![]() | Domain d2gzdd_: 2gzd D: [135904] Other proteins in same PDB: d2gzda_, d2gzdb_ automated match to d2gzdc1 complexed with gtp, mg |
PDB Entry: 2gzd (more details), 2.44 Å
SCOPe Domain Sequences for d2gzdd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gzdd_ h.1.31.1 (D:) Rab11 family-interacting protein 2 {Human (Homo sapiens) [TaxId: 9606]} rrkdthireledyidnllvrvmeetpsilrvpyep
Timeline for d2gzdd_: