Lineage for d2gzdc1 (2gzd C:468-502)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040629Superfamily h.1.31: Eferin C-derminal domain-like [144270] (1 family) (S)
  5. 3040630Family h.1.31.1: Eferin C-derminal domain-like [144271] (3 proteins)
    contains PfamB PB042332, PfamB PB026102
  6. 3040631Protein Rab11 family-interacting protein 2 [144272] (1 species)
  7. 3040632Species Human (Homo sapiens) [TaxId:9606] [144273] (2 PDB entries)
    Uniprot Q7L804 468-502
  8. 3040634Domain d2gzdc1: 2gzd C:468-502 [135903]
    Other proteins in same PDB: d2gzda_, d2gzdb_
    complexed with gtp, mg

Details for d2gzdc1

PDB Entry: 2gzd (more details), 2.44 Å

PDB Description: crystal structure of rab11 in complex with rab11-fip2
PDB Compounds: (C:) Rab11 family-interacting protein 2

SCOPe Domain Sequences for d2gzdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gzdc1 h.1.31.1 (C:468-502) Rab11 family-interacting protein 2 {Human (Homo sapiens) [TaxId: 9606]}
rrkdthireledyidnllvrvmeetpsilrvpyep

SCOPe Domain Coordinates for d2gzdc1:

Click to download the PDB-style file with coordinates for d2gzdc1.
(The format of our PDB-style files is described here.)

Timeline for d2gzdc1: