Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab11a [102362] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [102363] (9 PDB entries) |
Domain d2gzdb1: 2gzd B:8-173 [135902] Other proteins in same PDB: d2gzdc1, d2gzdd1 automatically matched to d1oiwa_ complexed with gtp, mg; mutant |
PDB Entry: 2gzd (more details), 2.44 Å
SCOP Domain Sequences for d2gzdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gzdb1 c.37.1.8 (B:8-173) Rab11a {Human (Homo sapiens) [TaxId: 9606]} ydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwdt agleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksd lrhlravptdearafaeknglsfietsaldstnveaafqtilteiy
Timeline for d2gzdb1: