SCOPe 2.08: Domain d2gzdb_: 2gzd B:

Lineage for d2gzdb_ (2gzd B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d2gzdb_: 2gzd B: [135902]
   Other proteins in same PDB: d2gzdc1, d2gzdd_
   automated match to d1oiva_
   complexed with gtp, mg

Details for d2gzdb_

PDB Entry: 2gzd, 2.44 Å

PDB Description: crystal structure of rab11 in complex with rab11-fip2

PDB Compounds: (B:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d2gzdb_:

Sequence; same for both SEQRES and ATOM records:

>d2gzdb_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
tagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
dlrhlravptdearafaeknglsfietsaldstnveaafqtilteiy

Timeline for d2gzdb_:

• d2gzdb_ first appeared in SCOP 1.73, called d2gzdb1
  
• d2gzdb_ appears in SCOPe 2.07