Lineage for d2gz3a2 (2gz3 A:128-329)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727888Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 727889Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 727890Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 727897Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)
  7. 727928Species Streptococcus pneumoniae [TaxId:1313] [143538] (4 PDB entries)
  8. 727937Domain d2gz3a2: 2gz3 A:128-329 [135896]
    Other proteins in same PDB: d2gz3a1, d2gz3c1, d2gz3d1
    automatically matched to 2GYY A:128-329
    complexed with as2, nap

Details for d2gz3a2

PDB Entry: 2gz3 (more details), 2.1 Å

PDB Description: Structure of Aspartate Semialdehyde Dehydrogenase (ASADH) from Streptococcus pneumoniae complexed with NADP and aspartate-semialdehyde
PDB Compounds: (A:) Aspartate beta-semialdehyde dehydrogenase

SCOP Domain Sequences for d2gz3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gz3a2 d.81.1.1 (A:128-329) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]}
cstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvkpcdlha
eilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsatcvrip
vlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrdtfvgri
rkdldaekgihmwvvsdnllkg

SCOP Domain Coordinates for d2gz3a2:

Click to download the PDB-style file with coordinates for d2gz3a2.
(The format of our PDB-style files is described here.)

Timeline for d2gz3a2: