![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.81: FwdE/GAPDH domain-like [55346] (3 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
![]() | Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species) |
![]() | Species Streptococcus pneumoniae [TaxId:1313] [143538] (4 PDB entries) |
![]() | Domain d2gz3a2: 2gz3 A:128-329 [135896] Other proteins in same PDB: d2gz3a1, d2gz3c1, d2gz3d1 automatically matched to 2GYY A:128-329 complexed with as2, nap |
PDB Entry: 2gz3 (more details), 2.1 Å
SCOP Domain Sequences for d2gz3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gz3a2 d.81.1.1 (A:128-329) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} cstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvkpcdlha eilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsatcvrip vlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrdtfvgri rkdldaekgihmwvvsdnllkg
Timeline for d2gz3a2:
![]() Domains from other chains: (mouse over for more information) d2gz3c1, d2gz3c2, d2gz3d1, d2gz3d2 |