SCOP 1.73: Domain d2gz3a1: 2gz3 A:2-127,A:330-357

Lineage for d2gz3a1 (2gz3 A:2-127,A:330-357)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [141917] (4 PDB entries)

8. Domain d2gz3a1: 2gz3 A:2-127,A:330-357 [135895]
   Other proteins in same PDB: d2gz3a2, d2gz3c2, d2gz3d2
   automatically matched to 2GYY A:2-127,A:330-357
   complexed with as2, nap

Details for d2gz3a1

PDB Entry: 2gz3, 2.1 Å

PDB Description: Structure of Aspartate Semialdehyde Dehydrogenase (ASADH) from Streptococcus pneumoniae complexed with NADP and aspartate-semialdehyde

PDB Compounds: (A:) Aspartate beta-semialdehyde dehydrogenase

SCOP Domain Sequences for d2gz3a1:

Sequence; same for both SEQRES and ATOM records:

>d2gz3a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]}
gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta
fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng
iiacpnXaawnsvqiaetlherglvrptaelkfel

Timeline for d2gz3a1:

• d2gz3a1 is new in SCOP 1.73
  
• d2gz3a1 appears in SCOP 1.75
  
• d2gz3a1 appears in the current release, SCOPe 2.08