Lineage for d2gz3a1 (2gz3 A:2-127,A:330-358)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2843586Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species)
  7. 2843617Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [141917] (18 PDB entries)
    Uniprot Q8DQ00 2-127,330-357
  8. 2843638Domain d2gz3a1: 2gz3 A:2-127,A:330-358 [135895]
    Other proteins in same PDB: d2gz3a2, d2gz3b2, d2gz3c2, d2gz3d2
    automated match to d2gyya1
    complexed with as2, nap

Details for d2gz3a1

PDB Entry: 2gz3 (more details), 2.1 Å

PDB Description: Structure of Aspartate Semialdehyde Dehydrogenase (ASADH) from Streptococcus pneumoniae complexed with NADP and aspartate-semialdehyde
PDB Compounds: (A:) Aspartate beta-semialdehyde dehydrogenase

SCOPe Domain Sequences for d2gz3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gz3a1 c.2.1.3 (A:2-127,A:330-358) Aspartate beta-semialdehyde dehydrogenase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
gytvavvgatgavgaqmikmleestlpidkirylasarsagkslkfkdqditieetteta
fegvdialfsagsstsakyapyavkagvvvvdntsyfrqnpdvplvvpevnahaldahng
iiacpnXaawnsvqiaetlherglvrptaelkfelk

SCOPe Domain Coordinates for d2gz3a1:

Click to download the PDB-style file with coordinates for d2gz3a1.
(The format of our PDB-style files is described here.)

Timeline for d2gz3a1: