| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
| Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
| Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species) |
| Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143538] (18 PDB entries) Uniprot Q8DQ00 128-329 |
| Domain d2gz2b2: 2gz2 B:128-329 [135894] Other proteins in same PDB: d2gz2a1, d2gz2b1 automated match to d2gyya2 complexed with a2p |
PDB Entry: 2gz2 (more details), 2.1 Å
SCOPe Domain Sequences for d2gz2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gz2b2 d.81.1.1 (B:128-329) Aspartate beta-semialdehyde dehydrogenase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
cstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvkpcdlha
eilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsatcvrip
vlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrdtfvgri
rkdldaekgihmwvvsdnllkg
Timeline for d2gz2b2: